HPA019011

IL17RE antibody from Sigma-Aldrich
FLJ23658
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA019011
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA019011, RRID:AB_1851667
Product name
Anti-IL17RE antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA019011
Antibody type
Polyclonal
Antigen
Interleukin-17 receptor E precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EKSHHISIPSPDISHKGLRSKRTQPSDPETWESLP
RLDSQRHGGPEFSFDLLPEARAIRVTISSGPEVSV
RLCHQWALECEELSSPYDVQKIVSGGHTVELPYEF
LLPCLCMEASYLQEDTVRRKKCPFQSWPEAYGSDF
WKSVHFTDYS
Storage
-20C
Provider Type Product Number
- No reagents -