Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA039170 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA039170, RRID:AB_10673414
- Product name
- Anti-HERC3
- Antibody type
- Polyclonal
- Reactivity
- Human, Rat
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
NYSPAVDFRTMNQAHYTSLINDETIAVWRQKLSEH
NNANTINGVVQILSSAACWNGSFLEKKIDEHFKTS
PKIPGIDLNSTRV- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references HERC3 directly targets RPL23A for ubiquitination degradation and further regulates Colorectal Cancer proliferation and the cell cycle
HERC3 regulates epithelial-mesenchymal transition by directly ubiquitination degradation EIF5A2 and inhibits metastasis of colorectal cancer
The ubiquitin ligase HERC3 attenuates NF-κB-dependent transcription independently of its enzymatic activity by delivering the RelA subunit for degradation
Zhang Z, Wu Q, Fang M, Liu Y, Jiang J, Feng Q, Hu R, Xu J
International Journal of Biological Sciences 2022;18(8):3282-3297
International Journal of Biological Sciences 2022;18(8):3282-3297
HERC3 regulates epithelial-mesenchymal transition by directly ubiquitination degradation EIF5A2 and inhibits metastasis of colorectal cancer
Zhang Z, He G, Lv Y, Liu Y, Niu Z, Feng Q, Hu R, Xu J
Cell Death & Disease 2022;13(1)
Cell Death & Disease 2022;13(1)
The ubiquitin ligase HERC3 attenuates NF-κB-dependent transcription independently of its enzymatic activity by delivering the RelA subunit for degradation
Hochrainer K, Pejanovic N, Olaseun V, Zhang S, Iadecola C, Anrather J
Nucleic Acids Research 2015
Nucleic Acids Research 2015
No comments: Submit comment
No validations: Submit validation data