HPA010979

antibody from Atlas Antibodies

Targeting: CDCP1 CD318, SIMA135

Antibody data

Submit

Validation data

Product number: HPA010979 - Provider product page
Provider: Atlas Antibodies
Proper citation: Atlas Antibodies Cat#HPA010979, RRID:AB_1846401
Product name: Anti-CDCP1
Antibody type: Polyclonal
Reactivity: Human
Host: Rabbit
Conjugate: Unconjugated
Antigen sequence: GFSIANRSSIKRLCIIESVFEGEGSATLMSANYPE GFPEDELMTWQFVVPAHLRASVSFLNFNLSNCERK EERVEYYIPGSTTNPEVFKLEDKQPGNMAGNFNLS LQGCDQDAQSPGILRLQFQVLVQHPQNESNKIYVV DLSNERA
Isotype: IgG
Vial size: 100 µl
Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C.

CDCP1 protein structure - HPA010979 shown in red.

Enhanced validation

Submitted by: Atlas Antibodies (provider)
Enhanced method: Orthogonal validation
Main image
Experimental details: Immunohistochemistry analysis in human duodenum and lymph node tissues using HPA010979 antibody. Corresponding CDCP1 RNA-seq data are presented for the same tissues.
Sample type: HUMAN
Orthogonal method: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human esophagus shows high expression.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows low expression as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human cervix shows weak to moderate membranous positivity in squamous epithelial cells.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human lymph node shows no positivity in non-germinal center cells as expected.
Sample type: HUMAN

Supportive validation

Submitted by: Atlas Antibodies (provider)
Main image
Experimental details: Immunohistochemical staining of human duodenum shows strong membranous positivity in glandular cells.
Sample type: HUMAN