HPA010978

CDCP1 antibody from Sigma-Aldrich
CD318, SIMA135
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010978
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010978, RRID:AB_1846403
Product name
Anti-CDCP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010978
Antibody type
Polyclonal
Antigen
CUB domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
SKHKISFLCDDLTRLWMNVEKTISCTDHRYCQRKS
YSLQVPSDILHLPVELHDFSWKLLVPKDRLSLVLV
PAQKLQQHTHEKPCNTSFSYLVASAIPSQDLYFGS
FCPGGSIKQIQVKQ
Storage
-20C
Provider Type Product Number
- No reagents -