H00083597-A01

RTP3 antibody from Abnova Corporation
LTM1, TMEM7, Z3CXXC3
No application information provided.

Antibody data

Product number
H00083597-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00083597-A01, RRID:AB_535359
Product name
TMEM7 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00083597-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant TMEM7.
Antigen sequence
RGQVKMRVFTQRCKKCPQPLFEDPEFTQENISRIL
KNLVFRILKKCYRGRFQLIEEVPMIKDISLEGPHN
SDNCEACLQGFCAGPIQVTSLPPSQTPRVH
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -