HPA013842

RTP3 antibody from Sigma-Aldrich
LTM1, TMEM7, Z3CXXC3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013842
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013842, RRID:AB_1858131
Product name
Anti-RTP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013842
Antibody type
Polyclonal
Antigen
Receptor-transporting protein 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QVLVLFHMNWSEEKSRGQVKMRVFTQRCKKCPQPL
FEDPEFTQENISRILKNLVFRILKKCYRGRFQLIE
EVPMIKDISLEGPHNSDNCEACLQGFCAGPIQVTS
LPPSQTPRVHSIYKVEEVVKPWA
Storage
-20C
Provider Type Product Number
- No reagents -