Antibody data

Product number
H00266812-B03
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00266812-B03, RRID:AB_1577583
Product name
NAP1L5 MaxPab mouse polyclonal antibody (B03)
Provider product page
Abnova Corporation - H00266812-B03
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human NAP1L5 protein.
Antigen sequence
MADSENQGPAEPSQAAAAAEAAAEEVMAEGGAQGG
DCDSAAGDPDSAAGQMAEEPQTPAENAPKPKNDFI
ESLPNSVKCRVLALKKLQKRCDKIEAKFDKEFQAL
EKKYNDIYKPLLAKIQELTGEMEGCAWTLEGEEEE
EEEYEDDEEEGEDEEEEEAAAEAAAGAKHDDAHAE
MPDDAKK
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -