HPA010980

CCDC51 antibody from Sigma-Aldrich
FLJ12436
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010980
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010980, RRID:AB_1846155
Product name
Anti-CCDC51 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010980
Antibody type
Polyclonal
Antigen
Coiled-coil domain-containing protein 51 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
GLNEVREAQGKVTEAEKVFMVARGLVREAREDLEV
HQAKLKEVRDRLDRVSREDSQYLELATLEHRMLQE
EKRLRTAYLRAEDSEREKFSLFSAAVRESHEKERT
RAERTKNWSLIGSVLGALIGVAGS
Storage
-20C
Provider Type Product Number
- No reagents -