HPA028823

CEP120 antibody from MilliporeSigma / Merck KGaA
CCDC100, FLJ36090
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA028823
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA028823, RRID:AB_10601355
Product name
Anti-CEP120 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA028823
Antibody type
Polyclonal
Antigen
centrosomal protein 120kDa recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EEGGYHQIGPAEYCTDSFIMSVTIAFATQLEQLIP
CTMKLPERQPEFFFYYSLLGNDVTNEPFNDLINPN
FEPERASVRIRSSVEILRVYLALQSKLQIHLCCGD
QSLGSTEIPLTGLLKKGSTEINQHPVTVEGAF
Storage
-20C
Provider Type Product Number
- No reagents -