HPA027010

CSNK1G3 antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA027010
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA027010, RRID:AB_10602803
Product name
Anti-CSNK1G3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA027010
Antibody type
Polyclonal
Antigen
casein kinase 1, gamma 3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MFDYEYDWIGKQLPTPVGAVQQDPALSSNREAHQH
RDKMQQSKNQVVSSTNGELNTDDPTAGRSNAPITA
PTEVEVMDETNCQKV
Storage
-20C
Provider Type Product Number
- No reagents -