HPA031611

FOXRED2 antibody from MilliporeSigma / Merck KGaA
ERFAD, FLJ23322
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031611
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031611, RRID:AB_10599975
Product name
Anti-FOXRED2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031611
Antibody type
Polyclonal
Antigen
FAD-dependent oxidoreductase domain containing 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CVLGAGPAGLQMAYFLQRAGRDYAVFERAPRPGSF
FTRYPRHRKLISINKRYTGKANAEFNLRHDWNSLL
SHDPRLLFRHYSRAYFPDARDMVRYLGDFADTLGL
RVQYNTTIAHVTLDKDRQAWNGHYFILTDQKG
Storage
-20C
Provider Type Product Number
- No reagents -