HPA031612

FOXRED2 antibody from MilliporeSigma / Merck KGaA
ERFAD, FLJ23322
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031612
Provider
MilliporeSigma / Merck KGaA
Product name
Anti-FOXRED2 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031612
Antibody type
Polyclonal
Antigen
FAD-dependent oxidoreductase domain containing 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YVGDLRAINNGLLDTYQLKSLDGLLESDLTDLAIL
KDSKGKFHVTPKFFLEEANTNQSADSITLPQDDND
NFAMRVPYDRVIRCLGWNFDFSIFNKSLRLNSGNA
FGKKYPLIRASYESKGSRGLFILGTASHSVDYRKS
AGGFIHGFRY
Storage
-20C