Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00001479-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00001479-M01, RRID:AB_463802
- Product name
- CSTF3 monoclonal antibody (M01), clone 1D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant CSTF3.
- Antigen sequence
MSGDGATEQAAEYVPEKVKKAEKKLEENPYDLDAW
SILIREAQNQPIDKARKTYERLVAQFPSSGRFWKL
YIEAEVTILFYFFLYQYCSIHCSDRKQVRNIAN- Isotype
- IgG
- Antibody clone number
- 1D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Polyadenylation site-specific differences in the activity of the neuronal βCstF-64 protein in PC-12 cells.
Shankarling GS, MacDonald CC
Gene 2013 Oct 25;529(2):220-7
Gene 2013 Oct 25;529(2):220-7
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CSTF3 expression in transfected 293T cell line by CSTF3 monoclonal antibody (M01), clone 1D4.Lane 1: CSTF3 transfected lysate(11.44 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CSTF3 is approximately 0.1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to CSTF3 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to CSTF3 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol