HPA012165

LMBRD2 antibody from Sigma-Aldrich
DKFZp434H2226
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012165
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012165, RRID:AB_2136131
Product name
Anti-LMBRD2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012165
Antibody type
Polyclonal
Antigen
LMBR1 domain-containing protein 2 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
CLNLLGFQQFMGDDDMTSDLVNEGKELIRKEKRKR
QRQEEGENRRREWKERYGHNREDSTRNRNIHTDPK
ESNFSDVNTNRSAFKYTRANNRTERDRIELLQDAE
PLDFNAETFTDDPLESESGRYQPGGRYLSMSRSD
Storage
-20C
Provider Type Product Number
- No reagents -