HPA012814

FANCG antibody from Sigma-Aldrich
FAG, XRCC9
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012814
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012814, RRID:AB_1858729
Product name
Anti-VCP antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012814
Antibody type
Polyclonal
Antigen
Transitional endoplasmic reticulum ATPase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PVAKDVDLEFLAKMTNGFSGADLTEICQRACKLAI
RESIESEIRRERERQTNPSAMEVEEDDPVPEIRRD
HFEEAMRFARRSVSDNDIRKYEMFAQTLQQSRGFG
SFRF
Storage
-20C
Provider Type Product Number
- No reagents -