HPA011410

PEX2 antibody from Sigma-Aldrich
PAF-1, PMP35, PXMP3, RNF72, ZWS3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011410
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011410, RRID:AB_1854922
Product name
Anti-PXMP3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011410
Antibody type
Polyclonal
Antigen
Peroxisome assembly factor 1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NAKSANRVLRISQLDALELNKALEQLVWSQFTQCF
HGFKPGLLARFEPEVKACLWVFLWRFTIYSKNATV
GQSVLNIKYKNDFSPNLRYQPPSKNQKIWYAVCTI
GGRWLEERCYDLFRNHHLASFGKVKQ
Storage
-20C
Provider Type Product Number
- No reagents -