HPA013843

SLITRK5 antibody from Sigma-Aldrich
bA364G4.2, KIAA0918, LRRC11
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA013843
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA013843, RRID:AB_1857233
Product name
Anti-SLITRK5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA013843
Antibody type
Polyclonal
Antigen
SLIT and NTRK-like protein 5 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKSLIQIDLHDNPWDCTCDIVGMKLWVEQLKVGVL
VDEVICKAPKKFAETDMRSIKSELLCPDYSDVVVS
TPTPSSIQVPARTSAVTPAVRLNSTGAPASLGAGG
GASSVPL
Storage
-20C
Provider Type Product Number
- No reagents -