HPA013843

SLITRK5 antibody from Atlas Antibodies
bA364G4.2, KIAA0918, LRRC11
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA013843
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA013843, RRID:AB_1857233
Product name
Anti-SLITRK5
Provider product page
Atlas Antibodies - HPA013843
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LKSLIQIDLHDNPWDCTCDIVGMKLWVEQLKVGVL
VDEVICKAPKKFAETDMRSIKSELLCPDYSDVVVS
TPTPSSIQVPARTSAVTPAVRLNSTGAPASLGAGG
GASSVPL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -