H00283807-A01

FBXL22 antibody from Abnova Corporation
Fbl22, FLJ39626
No application information provided.

Antibody data

Product number
H00283807-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00283807-A01, RRID:AB_463464
Product name
FBXL22 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00283807-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant FBXL22.
Antigen sequence
MHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHD
VFEDPALWSLLHFRSLTELQKDNFLLGPALRSLSI
CWHSSRVQVCSIEDWLKSAFQRSICSRHESLVNDF
LLRVC
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -