H00283807-M01

FBXL22 antibody from Abnova Corporation
Fbl22, FLJ39626

Antibody data

Product number
H00283807-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00283807-M01, RRID:AB_606225
Product name
FBXL22 monoclonal antibody (M01), clone 1B6
Provider product page
Abnova Corporation - H00283807-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant FBXL22.
Antigen sequence
MHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHD
VFEDPALWSLLHFRSLTELQKDNFLLGPALRSLSI
CWHSSRVQVCSIEDWLKSAFQRSICSRHESLVNDF
LLRVC
Isotype
IgG
Antibody clone number
1B6
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -