HPA047624

FBXL22 antibody from Atlas Antibodies
Fbl22, FLJ39626
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA047624
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA047624, RRID:AB_2680107
Product name
Anti-FBXL22
Provider product page
Atlas Antibodies - HPA047624
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
HITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDV
FEDPALWSLLHFRSLTELQKDNFLLGPALRSLSIC
WHS
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -