SAB1402082

FBXL22 antibody from MilliporeSigma / Merck KGaA
Fbl22, FLJ39626
ELISA
Recommended by provider

Antibody data

Product number
SAB1402082
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#SAB1402082, RRID:AB_10606509
Product name
Monoclonal Anti-FBXL22 antibody produced in mouse
Provider product page
MilliporeSigma / Merck KGaA - SAB1402082
Antibody type
Monoclonal
Antigen
FBXL22 (NP_976307, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Description
ascites fluid
Reactivity
Human
Antigen sequence
MHITQLNRECLLHLFSFLDKDSRKSLARTCSQLHD
VFEDPALWSLLHFRSLTELQKDNFLLGPALRSLSI
CWHSSRVQVCSIEDWLKSAFQRSICSRHESLVNDF
LLRVC*
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -