Explore
Validate
LearnPAB27902
antibody from Abnova Corporation
Targeting: CHMP4B
C20orf178, dJ553F4.4, Shax1, SNF7-2, VPS32B
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- PAB27902 - Provider product page
- Provider
- Abnova Corporation
- Product name
- CHMP4B polyclonal antibody
- Antibody type
- Polyclonal
- Description
- Rabbit polyclonal antibody raised against recombinant CHMP4B.
- Antigen sequence
SVFGKLFGAGGGKAGKGGPTPQEAIQRLRDTEEML
SKK- Isotype
- IgG
- Storage
- Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western blot analysis of Lane 1: Negative control (vector only transfected HEK293T lysate).Lane 2: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells with CHMP4B polyclonal antibody (Cat # PAB27902).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line U-2 OS with CHMP4B polyclonal antibody (Cat # PAB27902) at 1-4 ug/mL dilution shows positivity in mitochondria.
- Validation comment
- Immunofluorescence
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human rectum with CHMP4B polyclonal antibody (Cat # PAB27902) shows strong granular cytoplasmic positivity in glandular cells at 1:200-1:500 dilution.
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
