ABIN633066

antibody from antibodies-online

Targeting: CHMP4B C20orf178, dJ553F4.4, Shax1, SNF7-2, VPS32B

Western blot

Antibody data

Submit

Validation data

Product number: ABIN633066 - Provider product page
Provider: antibodies-online
Product name: anti-Charged Multivesicular Body Protein 4B (CHMP4B) (Middle Region) antibody
Antibody type: Polyclonal
Antigen: CHMP4 B antibody was raised using the middle region of CHMP4 corresponding to a region with amino acids RKKRYEKQLAQIDGTLSTIEFQREALENANTNTEVLKNMGYAAKAMKAAH
Description: Affinity purified
Reactivity: Human
Host: Rabbit
Epitope: Middle Region
Vial size: 50 μg
Concentration: 1 mg/mL
Storage: Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling: Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.

CHMP4B protein structure - ABIN633066 shown in red.