ABIN785659
antibody from antibodies-online
Targeting: CHMP4B
C20orf178, dJ553F4.4, Shax1, SNF7-2, VPS32B
Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN785659 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Charged Multivesicular Body Protein 4B (CHMP4B) (Middle Region) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-CHMP4B antibody: synthetic peptide directed towards the middle region of human CHMP4B
- Description
- Affinity Purified
- Reactivity
- Human
- Host
- Rabbit
- Antigen sequence
EEISTAISKPVGFGEEFDEDELMAELEELEQEELD
KNLLE ISGPETVPLP- Epitope
- Middle Region
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Charged multivesicular body protein 2B (CHMP2B) of the endosomal sorting complex required for transport-III (ESCRT-III) polymerizes into helical structures deforming the plasma membrane.
Bodon G, Chassefeyre R, Pernet-Gallay K, Martinelli N, Effantin G, Hulsik DL, Belly A, Goldberg Y, Chatellard-Causse C, Blot B, Schoehn G, Weissenhorn W, Sadoul R
The Journal of biological chemistry 2011 Nov 18;286(46):40276-86
The Journal of biological chemistry 2011 Nov 18;286(46):40276-86
No comments: Submit comment
No validations: Submit validation data