HPA017613

HEPACAM antibody from Sigma-Aldrich
FLJ25530, GLIALCAM, hepaCAM
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017613
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017613, RRID:AB_1850595
Product name
Anti-HEPACAM antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017613
Antibody type
Polyclonal
Antigen
Hepatocyte cell adhesion molecule precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
DRIRLFENGSLLLSDLQLADEGTYEVEISITDDTF
TGEKTINLTVDVPISRPQVLVASTTVLELSEAFTL
NCSHENGTKPSYTWLKDGKPLLNDSRMLLSPDQKV
LTI
Storage
-20C
Provider Type Product Number
- No reagents -