WH0118987M1

PDZD8 antibody from Sigma-Aldrich
bA129M16.2, FLJ34427, PDZK8
ELISA
Recommended by provider

Antibody data

Product number
WH0118987M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0118987M1, RRID:AB_1842926
Product name
Monoclonal Anti-PDZD8 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0118987M1
Antibody type
Monoclonal
Antigen
PDZD8 (NP_776152, a.a. 949-1059) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
RQVSKTRLSEPGTDLVEPSPKHTPNTSDNEGSDTE
VCGPNSPSKRGNSTGIKLVRKEGGLDDSVFIAVKE
IGRDLYRGLPTEERIQKLEFMLDKLQNEIDQELEH
NNSLV* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -