H00118987-M01

PDZD8 antibody from Abnova Corporation
bA129M16.2, FLJ34427, PDZK8

Antibody data

Product number
H00118987-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00118987-M01, RRID:AB_606751
Product name
PDZD8 monoclonal antibody (M01), clone 4E3
Provider product page
Abnova Corporation - H00118987-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant PDZD8.
Antigen sequence
RQVSKTRLSEPGTDLVEPSPKHTPNTSDNEGSDTE
VCGPNSPSKRGNSTGIKLVRKEGGLDDSVFIAVKE
IGRDLYRGLPTEERIQKLEFMLDKLQNEIDQELEH
NNSLV
Isotype
IgG
Antibody clone number
4E3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -