H00118987-A01

PDZD8 antibody from Abnova Corporation
bA129M16.2, FLJ34427, PDZK8
No application information provided.

Antibody data

Product number
H00118987-A01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00118987-A01, RRID:AB_463133
Product name
PDZK8 polyclonal antibody (A01)
Provider product page
Abnova Corporation - H00118987-A01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a partial recombinant PDZK8.
Antigen sequence
RQVSKTRLSEPGTDLVEPSPKHTPNTSDNEGSDTE
VCGPNSPSKRGNSTGIKLVRKEGGLDDSVFIAVKE
IGRDLYRGLPTEERIQKLEFMLDKLQNEIDQELEH
NNSLV
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -