HPA051610

PDZD8 antibody from Atlas Antibodies
bA129M16.2, FLJ34427, PDZK8

Antibody data

Product number
HPA051610
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA051610, RRID:AB_2681549
Product name
Anti-PDZD8
Provider product page
Atlas Antibodies - HPA051610
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
DEEHIHIQQWALTEGRLKVTLLECSRLLIFGSYDR
EANVHCTLELSSSVWEEKQRSSIKTVELIKGNLQS
VGLTLRLVQSTDGYAGHVIIETVAPNSPAAIADLQ
RGDR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -