HPA015716

PDZD8 antibody from Atlas Antibodies
bA129M16.2, FLJ34427, PDZK8
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA015716
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA015716, RRID:AB_1855162
Product name
Anti-PDZD8
Provider product page
Atlas Antibodies - HPA015716
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SCLFDIEACHRYLNIALWCRDPFKLGGLICLGHVS
LKLEDVALGCLATSNTEYLSKLRLEAPSPKAIVTR
TALRNLSMQKGFNDKFCYGDITIHFKYLKEGESDH
HVVTNVEKEKEPHLVEEVSVLPKEEQFVGQMGLTE
NKHSFQDTQF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -