H00022921-M01

MSRB2 antibody from Abnova Corporation
CBS-1, CBS1, CGI-131, MSRB, PILB

Antibody data

Product number
H00022921-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00022921-M01, RRID:AB_489823
Product name
MSRB2 monoclonal antibody (M01), clone 2B7
Provider product page
Abnova Corporation - H00022921-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant MSRB2.
Antigen sequence
KEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAH
GTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAH
LGHVFPDGPGPNGQRFCINSVALKFKPRKH
Isotype
IgG
Antibody clone number
2B7
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.