Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00022921-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00022921-M01, RRID:AB_489823
- Product name
- MSRB2 monoclonal antibody (M01), clone 2B7
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant MSRB2.
- Antigen sequence
KEAGMYHCVCCDSPLFSSEKKYCSGTGWPSFSEAH
GTSGSDESHTGILRRLDTSLGSARTEVVCKQCEAH
LGHVFPDGPGPNGQRFCINSVALKFKPRKH- Isotype
- IgG
- Antibody clone number
- 2B7
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Methionine sulfoxide reductase B2 is highly expressed in the retina and protects retinal pigmented epithelium cells from oxidative damage.
Pascual I, Larrayoz IM, Campos MM, Rodriguez IR
Experimental eye research 2010 Mar;90(3):420-8
Experimental eye research 2010 Mar;90(3):420-8
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of MSRB2 expression in transfected 293T cell line by MSRB2 monoclonal antibody (M01), clone 2B7.Lane 1: MSRB2 transfected lysate (Predicted MW: 11.11 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged MSRB2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol