HPA012716

QSOX2 antibody from Sigma-Aldrich
DKFZp762A2013, QSCN6L1, SOXN
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012716
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012716, RRID:AB_2173315
Product name
Anti-QSOX2 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012716
Antibody type
Polyclonal
Antigen
Sulfhydryl oxidase 2 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LWKKHNMVNGRLAGHLSEDPRFPKLQWPTPDLCPA
CHEEIKGLASWDEGHVLTFLKQHYGRDNLLDTYSA
DQGDSSEGGTLARGEEEEKRLTPPEVSHGDRDTQS
VRPPGALGPRPALPESLHHSLDGKL
Storage
-20C
Provider Type Product Number
- No reagents -