HPA012716

QSOX2 antibody from Atlas Antibodies
DKFZp762A2013, QSCN6L1, SOXN
Validated within the Antibodypedia Validation Initative

Antibody data

Product number
HPA012716
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012716, RRID:AB_2173315
Product name
Anti-QSOX2
Provider product page
Atlas Antibodies - HPA012716
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LWKKHNMVNGRLAGHLSEDPRFPKLQWPTPDLCPA
CHEEIKGLASWDEGHVLTFLKQHYGRDNLLDTYSA
DQGDSSEGGTLARGEEEEKRLTPPEVSHGDRDTQS
VRPPGALGPRPALPESLHHSLDGKL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -