Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00008894-M09 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00008894-M09, RRID:AB_1237692
- Product name
- EIF2S2 monoclonal antibody (M09), clone 2F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant EIF2S2.
- Antigen sequence
MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEE
TQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDL
DDLNFFNQKKKKKKTKKIFDIDEAEEGVKD- Isotype
- IgG
- Antibody clone number
- 2F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of EIF2S2 expression in transfected 293T cell line by EIF2S2 monoclonal antibody (M09), clone 2F3.Lane 1: EIF2S2 transfected lysate(38.4 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- EIF2S2 monoclonal antibody (M09), clone 2F3. Western Blot analysis of EIF2S2 expression in Raw 264.7(Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged EIF2S2 is 0.3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to EIF2S2 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to EIF2S2 on formalin-fixed paraffin-embedded human pancreatic cancer. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol