Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [2]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA077805 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA077805, RRID:AB_2686855
- Product name
- Anti-PRKAG1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
METVISSDSSPAVENEHPQETPESNNSVYT
- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm & cytosol.
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunofluorescent staining of human cell line PC-3 shows localization to nucleoplasm, nuclear bodies & cytosol.
- Sample type
- HUMAN