HPA012928

TMEM130 antibody from Sigma-Aldrich
DKFZp761L1417, FLJ42643
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012928
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012928, RRID:AB_1858085
Product name
Anti-TMEM130 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012928
Antibody type
Polyclonal
Antigen
Transmembrane protein 130 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NATQQKDMVENPEPPSGVRCCCQMCCGPFLLETPS
EYLEIVRENHGLLPPLYKSVK
Storage
-20C
Provider Type Product Number
- No reagents -