H00255762-B01

PDZD9 antibody from Abnova Corporation
C16orf65, MGC50721

Antibody data

Product number
H00255762-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00255762-B01, RRID:AB_1204678
Product name
MGC50721 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00255762-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human MGC50721 protein.
Antigen sequence
MAEGEEEGGDVLISVGHANVLGYTLREFLQLLQHI
TIGTVLQIKVYRDFINIPEEWQEIYDLIPEAKFPV
TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRY
PWSTVHHPARRPISISRDWHGYKKKNHTISVGKDI
NCDVMIHRDDKKEVRAPSPYWIMVKQDNESSSSST
SSTSDAFWLEDCAQVEEGKAQLVSKVG
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -