HPA001149

C22orf23 antibody from Sigma-Aldrich
EVG1, FLJ32787, LOC84645
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA001149
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA001149, RRID:AB_1078349
Product name
Anti-C22orf23 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA001149
Antibody type
Polyclonal
Antigen
UPF0193 protein EVG1 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQCSPTSSQRVLPSKQIASPIYLPPILAARPHLRP
ANMCQANGAYSREQFKPQATRDLEKEKQRLQNIFA
TGKDMEERKRKAPPARQKAPAPELDRFEELVKEIQ
ERKEFLADMEALGQGKQYRGIILAEISQKLREMED
IDHRRSEE
Storage
-20C
Provider Type Product Number
- No reagents -