HPA014157

TMX3 antibody from Sigma-Aldrich
FLJ20793, KIAA1830, PDIA13, TXNDC10
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA014157
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA014157, RRID:AB_1858469
Product name
Anti-TMX3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA014157
Antibody type
Polyclonal
Antigen
Protein disulfide-isomerase TXNDC10 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VVVLDMVVCKGFVEDLDESFKENRNDDIWLVDFYA
PWCGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDAT
SYSSIASEFGVRGYPTIKLLKGDLAYNYRGPRTKD
DIIEFAHRVSGALIRPLPSQQMF
Storage
-20C
Provider Type Product Number
- No reagents -