H00009768-M01
antibody from Abnova Corporation
Targeting: PCLAF
KIAA0101, NS5ATP9, OEATC-1, p15(PAF), PAF15
Antibody data
- Antibody Data
- Antigen structure
- References [6]
- Comments [0]
- Validations
- ELISA [1]
- Immunocytochemistry [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00009768-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00009768-M01, RRID:AB_425819
- Product name
- KIAA0101 monoclonal antibody (M01), clone 3C11-1F11
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant KIAA0101.
- Antigen sequence
MVRTKADSVPGTYRKVVAARAPRKVLGSSTSATNS
TSVSSRKAENKYAGGNPVCVRPTPKWQKGIGEFFR
LSPKDSEKENQIPEEAGSSGLGKAKRKACPLQPDH
TNDEKE- Isotype
- IgG
- Antibody clone number
- 3C11-1F11
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references NS5ATP9 mRNA levels in peripheral blood mononuclear cells predict prognosis in patients with gastric cancer.
p15(PAF) is an Rb/E2F-regulated S-phase protein essential for DNA synthesis and cell cycle progression.
Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome.
Expression of KIAA0101 protein is associated with poor survival of esophageal cancer patients and resistance to cisplatin treatment in vitro.
Overexpression of KIAA0101 predicts poor prognosis in primary lung cancer patients.
Overexpression of KIAA0101 predicts high stage, early tumor recurrence, and poor prognosis of hepatocellular carcinoma.
Yuan D, Zhu K, Dang C, Zheng Y, Yan R, Shi L, Li K
Medical oncology (Northwood, London, England) 2014 Aug;31(8):106
Medical oncology (Northwood, London, England) 2014 Aug;31(8):106
p15(PAF) is an Rb/E2F-regulated S-phase protein essential for DNA synthesis and cell cycle progression.
Chang CN, Feng MJ, Chen YL, Yuan RH, Jeng YM
PloS one 2013;8(4):e61196
PloS one 2013;8(4):e61196
Elevated cyclin B2 expression in invasive breast carcinoma is associated with unfavorable clinical outcome.
Shubbar E, Kovács A, Hajizadeh S, Parris TZ, Nemes S, Gunnarsdóttir K, Einbeigi Z, Karlsson P, Helou K
BMC cancer 2013 Jan 2;13:1
BMC cancer 2013 Jan 2;13:1
Expression of KIAA0101 protein is associated with poor survival of esophageal cancer patients and resistance to cisplatin treatment in vitro.
Cheng Y, Li K, Diao D, Zhu K, Shi L, Zhang H, Yuan D, Guo Q, Wu X, Liu D, Dang C
Laboratory investigation; a journal of technical methods and pathology 2013 Dec;93(12):1276-87
Laboratory investigation; a journal of technical methods and pathology 2013 Dec;93(12):1276-87
Overexpression of KIAA0101 predicts poor prognosis in primary lung cancer patients.
Kato T, Daigo Y, Aragaki M, Ishikawa K, Sato M, Kaji M
Lung cancer (Amsterdam, Netherlands) 2012 Jan;75(1):110-8
Lung cancer (Amsterdam, Netherlands) 2012 Jan;75(1):110-8
Overexpression of KIAA0101 predicts high stage, early tumor recurrence, and poor prognosis of hepatocellular carcinoma.
Yuan RH, Jeng YM, Pan HW, Hu FC, Lai PL, Lee PH, Hsu HC
Clinical cancer research : an official journal of the American Association for Cancer Research 2007 Sep 15;13(18 Pt 1):5368-76
Clinical cancer research : an official journal of the American Association for Cancer Research 2007 Sep 15;13(18 Pt 1):5368-76
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged KIAA0101 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunofluorescence of monoclonal antibody to KIAA0101 on HeLa cell. [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to KIAA0101 on formalin-fixed paraffin-embedded human lymph node tissue. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol