HPA031530

VIRMA antibody from MilliporeSigma / Merck KGaA
DKFZP434I116, fSAP121, KIAA1429
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA031530
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA031530, RRID:AB_10600818
Product name
Anti-KIAA1429 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA031530
Antibody type
Polyclonal
Antigen
KIAA1429 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LSGRLDSDEQKIQNDIIDILLTFTQGVNEKLTISE
ETLANNTWSLMLKEVLSSILKVPEGFFSGLILLSE
LLPLPLPMQTTQVIEPHDISVALNTRKL
Storage
-20C
Provider Type Product Number
- No reagents -