Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Western blot [2]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00080975-M09 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00080975-M09, RRID:AB_1580948
- Product name
- TMPRSS5 monoclonal antibody (M09), clone 2E5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant TMPRSS5.
- Antigen sequence
HCMHSFRLARLSSWRVHAGLVSHSAVRPHQGALVE
RIIPHPLYSAQNHDYDVALLRLQTALNFSDTVGAV
CLPAKEQHFPKGSRCWVSGWGHTHPSHTYS- Isotype
- IgG
- Antibody clone number
- 2E5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- TMPRSS5 monoclonal antibody (M09), clone 2E5. Western Blot analysis of TMPRSS5 expression in human kidney.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of TMPRSS5 expression in transfected 293T cell line by TMPRSS5 monoclonal antibody (M09), clone 2E5.Lane 1: TMPRSS5 transfected lysate (Predicted MW: 49.6 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged TMPRSS5 is 3 ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol