HPA010992

TMPRSS5 antibody from Sigma-Aldrich
MGC141886, MGC148044
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010992
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010992, RRID:AB_1858152
Product name
Anti-TMPRSS5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010992
Antibody type
Polyclonal
Antigen
Transmembrane protease, serine 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LVERIIPHPLYSAQNHDYDVALLRLQTALNFSDTV
GAVCLPAKEQHFPKGSRCWVSGWGHTHPSHTYSSD
MLQDTVVPLFSTQLCNSSCVYSGALTPRMLCAGYL
DGRADACQGD
Storage
-20C
Provider Type Product Number
- No reagents -