HPA061001

RHEBL1 antibody from Atlas Antibodies
FLJ25797, MGC34869, RHEB2
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA061001
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA061001, RRID:AB_2684409
Product name
Anti-RHEBL1
Provider product page
Atlas Antibodies - HPA061001
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SSARENQLTQGIFTKVIQEIARVENSYGQERRCHL
M
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -