HPA015731

AC011330.2 antibody from MilliporeSigma / Merck KGaA
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA015731
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA015731, RRID:AB_1857617
Product name
Anti-STRC antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA015731
Antibody type
Polyclonal
Antigen
Stereocilin precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ACHDQFPDEFLDAICSNLSFSALSGSNRRLVKRLC
AGLLPPPTSCPEGLPPVPLTPDIFWGCFLENETLW
AERLCGEASLQAVPPSNQAWVQHVCQGPTPDVTAS
PPCHIGPCGERCPDGGSFLVMVCAND
Storage
-20C
Provider Type Product Number
- No reagents -