Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
- Immunoprecipitation [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010538-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010538-M01, RRID:AB_605973
- Product name
- BATF monoclonal antibody (M01), clone 8A12
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BATF.
- Antigen sequence
EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAAL
RKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSP
PEVVYSAHAFHQPHVSSPRFQP- Isotype
- IgG
- Antibody clone number
- 8A12
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Basic leucine zipper transcription factor, ATF-like (BATF) regulates epigenetically and energetically effector CD8 T-cell differentiation via Sirt1 expression.
Kuroda S, Yamazaki M, Abe M, Sakimura K, Takayanagi H, Iwai Y
Proceedings of the National Academy of Sciences of the United States of America 2011 Sep 6;108(36):14885-9
Proceedings of the National Academy of Sciences of the United States of America 2011 Sep 6;108(36):14885-9
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BATF monoclonal antibody (M01), clone 8A12 Western Blot analysis of BATF expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- BATF monoclonal antibody (M01), clone 8A12. Western Blot analysis of BATF expression in Raw 264.7 ( Cat # L024V1 ).
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of BATF expression in transfected 293T cell line by BATF monoclonal antibody (M01), clone 8A12.Lane 1: BATF transfected lysate(14.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged BATF is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoprecipitation of BATF transfected lysate using anti-BATF monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with BATF MaxPab rabbit polyclonal antibody.
- Validation comment
- Immunoprecipitation
- Protocol
- Protocol