Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [3]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00010538-M03 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00010538-M03, RRID:AB_714675
- Product name
- BATF monoclonal antibody (M03), clone 1G4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant BATF.
- Antigen sequence
EKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAAL
RKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSP
PEVVYSAHAFHQPHVSSPRFQP- Isotype
- IgG
- Antibody clone number
- 1G4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A differentiation checkpoint limits hematopoietic stem cell self-renewal in response to DNA damage.
Wang J, Sun Q, Morita Y, Jiang H, Gross A, Lechel A, Hildner K, Guachalla LM, Gompf A, Hartmann D, Schambach A, Wuestefeld T, Dauch D, Schrezenmeier H, Hofmann WK, Nakauchi H, Ju Z, Kestler HA, Zender L, Rudolph KL
Cell 2012 Mar 2;148(5):1001-14
Cell 2012 Mar 2;148(5):1001-14
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BATF monoclonal antibody (M03), clone 1G4 Western Blot analysis of BATF expression in Hela S3 NE ( Cat # L013V3 ).
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Western Blot analysis of BATF expression in transfected 293T cell line by BATF monoclonal antibody (M03), clone 1G4.Lane 1: BATF transfected lysate(14.1 KDa).Lane 2: Non-transfected lysate.
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- BATF monoclonal antibody (M03), clone 1G4. Western Blot analysis of BATF expression in Raw 264.7 ( Cat # L024V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged BATF is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol