HPA012720

PPIB antibody from Sigma-Aldrich
B, CYP-S1, CYPB, OI9, PPIase, SCYLP
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012720
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012720, RRID:AB_1847399
Product name
Anti-PPIB antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012720
Antibody type
Polyclonal
Antigen
Peptidyl-prolyl cis-trans isomerase B precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LKHYGPGWVSMANAGKDTNGSQFFITTVKTAWLDG
KHVVFGKVLEGMEVVRKVESTKTDSRDKPLKDVII
ADCGKIEVEKPFAIAKE
Storage
-20C
Provider Type Product Number
- No reagents -