H00023173-B01

METAP1 antibody from Abnova Corporation
KIAA0094, MAP1A, MetAP1A

Antibody data

Product number
H00023173-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00023173-B01, RRID:AB_1138602
Product name
METAP1 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00023173-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human METAP1 protein.
Antigen sequence
MSESEQALKGTSQIKLLSSEDIEGMRLVCRLAREV
LDVAAGMIKPGVTTEEIDHAVHLACIARNCYPSPL
NYYNFPKSCCTSVNEVICHGIPDRRPLQEGDIVNV
DITLYRNGYHGDLNETFFVGEVDDGARKLVQTTYE
CLMQAIDAVKPGVRYRELGNIIQKHAQANGFSVVR
SYCGHGIHKLFHTAPNVPHYAKNKAVGVMKSGHVF
TIEPMICEGGWQDETWPDGWTAVTRDGKRSAQFEH
TLLVTDTGCEILTRRLDSARPHFMSQF
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -